DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Pdp

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001245567.1 Gene:Pdp / 31683 FlyBaseID:FBgn0029958 Length:475 Species:Drosophila melanogaster


Alignment Length:368 Identity:84/368 - (22%)
Similarity:139/368 - (37%) Gaps:132/368 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EDAHTHILSLPDDPQAAFF-------AVYDGHGGASVAKYAGKHLHKFITK-------------- 80
            ||:.|         :|:|.       .::|||.||:..:...|.|.::::.              
  Fly    73 EDSRT---------EASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQVLREQMKQ 128

  Fly    81 ---------------------RPEY----------------RDNSIEVALKKAFLDFDREMLQNG 108
                                 :|.|                ||.|.|  |..|||..|.|:.|..
  Fly   129 GADSQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSE--LVNAFLQLDEEISQEA 191

  Fly   109 --SLDEQT-----AGCTAIVVLIRERRLYCANAGDSRAIACI----SGMVHA--LSVDHKPNDAK 160
              |.|.:|     :|..|.:|.|...:::.|:.||..|:..:    :...|:  |:::|..::..
  Fly   192 LTSNDVRTMNVALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQWHSKKLNIEHNADNMS 256

  Fly   161 ESKRIMASGGWVEFNRV--NG----NLALSRALGDFIYK--KNLLK-----------------TP 200
            |.:||:|.....|...|  ||    .||..||.|||.||  :.:::                 ||
  Fly   257 EVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEIMQQKVLPMFGVQAMAPNYYTP 321

  Fly   201 EEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMNSCL 265
              ..:||.|||:..::..:.:|:::|.||:||.:...||...|.:.|..        ::::....
  Fly   322 --PYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVSLVGEHINS--------KKILEPMR 376

  Fly   266 SPDGHTGNVGGDNMTVILVCLLHNKSYEDLAVRCGGKRKTPVE 308
            .|:|.|              .|...| :.||.|..|..:.||:
  Fly   377 LPEGDT--------------TLQEIS-QQLAERKAGLTRKPVD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 76/344 (22%)
PdpNP_001245567.1 PP2Cc 58..394 CDD:238083 80/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.