DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Pp2C1

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001284867.1 Gene:Pp2C1 / 31404 FlyBaseID:FBgn0022768 Length:1427 Species:Drosophila melanogaster


Alignment Length:397 Identity:100/397 - (25%)
Similarity:160/397 - (40%) Gaps:117/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLSEPVTTKDTACCA-NASYRVGSSCMQGWRVDMEDAHTHILSLPDDP-----QAAFFAVYDGHG 62
            |.|...|...:.|.: ..:.||...|.||.|..|||..:  ::..:.|     :.|||.:|||||
  Fly   237 TGSSASTGNPSPCSSLGVNMRVTGQCCQGGRKYMEDQFS--VAYQESPITHELEYAFFGIYDGHG 299

  Fly    63 GASVAKYAGKHLHKFITKRPEY---RDNSIEVALKKAFLDFDREMLQ---------NGSLDEQTA 115
            |...|.:|.:||...|.|:.::   :|..:..|:::.::.....|.:         ||.|  .||
  Fly   300 GPEAALFAKEHLMLEIVKQKQFWSDQDEDVLRAIREGYIATHFAMWREQEKWPRTANGHL--STA 362

  Fly   116 GCTAIVVLIRERRLYCANAGDSRAIACISGMV-------------HALSVDHKPNDAKESKRIMA 167
            |.||.|..:|..::|..:.||       ||:|             ..|:.||||....|..||..
  Fly   363 GTTATVAFMRREKIYIGHVGD-------SGIVLGYQNKGERNWRARPLTTDHKPESLAEKTRIQR 420

  Fly   168 SGGWVEFN----RVNGN----------------------LALSRALGDFIYKKNLLKTPEEQIVT 206
            |||.|...    ||..|                      ||::|:|||.....:..|   |.:|:
  Fly   421 SGGNVAIKSGVPRVVWNRPRDPMHRGPIRRRTLVDEIPFLAVARSLGDLWSYNSRFK---EFVVS 482

  Fly   207 AYPDVEVLDIT-EDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEPELICEELMN--SCLSPD 268
            ..|||:|:.|. .....::...||:|:|::..|....|.|        |.:..|::|  ..::| 
  Fly   483 PDPDVKVVKINPSTFRCLIFGTDGLWNVVTAQEAVDSVRK--------EHLIGEILNEQDVMNP- 538

  Fly   269 GHTGNVGGDNMTVILVCLLHNKSYEDLAVRCGGKRK-----TPVETVGDIQDQSVKVVTPCSQGS 328
                                :|:..|.|::....:|     |.|.||         ::||.::.:
  Fly   539 --------------------SKALVDQALKTWAAKKMRADNTSVVTV---------ILTPAARNN 574

  Fly   329 SGSSTSR 335
            |.::.:|
  Fly   575 SPTTPTR 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 84/322 (26%)
Pp2C1NP_001284867.1 PP2Cc 256..567 CDD:238083 92/362 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.