DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Ppm1k

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001101333.1 Gene:Ppm1k / 312381 RGDID:1308501 Length:372 Species:Rattus norvegicus


Alignment Length:234 Identity:78/234 - (33%)
Similarity:117/234 - (50%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKHLHKFITK-RPEYRDN 87
            ||.:.:.|.|.:.|| ......|.:  :..:|||||||||.:.|.:...|:.|.:|. .|  |:.
  Rat    95 VGCASLIGKRKENED-RFGFAQLTE--EVLYFAVYDGHGGPAAADFCHTHMEKCVTDLLP--REK 154

  Fly    88 SIEVALKKAFLDFDREMLQNGSLDEQ----TAGCTAIVVLIRER-RLYCANAGDSRAIACISGMV 147
            .:|..|..|||:.|:.......|...    |:|.||.|.|:|:. .|..|:.|||||:.|..|..
  Rat   155 DLETVLTLAFLEIDKAFSSYAHLSADASLLTSGTTATVALLRDGVELVVASVGDSRALLCRKGKP 219

  Fly   148 HALSVDHKPNDAKESKRIMASGGWVEFN-----RVNGNLALSRALGDFIYK-KNLLKTPEEQIVT 206
            ..|:.||.|....|.:||...||:|.:|     .|||.||::|::||...| ..::..||...:.
  Rat   220 MKLTTDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKASGVIAEPETTRIK 284

  Fly   207 AYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHK 245
            .|        ..|..|::|..|||..::::.|:|.||::
  Rat   285 LY--------HADDSFLVLTTDGINFMVNSQEICDFVNQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 78/234 (33%)
Ppm1kNP_001101333.1 PP2Cc 95..346 CDD:238083 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.