DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Pptc7

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:203 Identity:53/203 - (26%)
Similarity:79/203 - (38%) Gaps:53/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 EMLQN--GSLDEQTAGCTAIVVLIR-ERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKR 164
            |:|||  ..|...||   .||||.| ..||:.||.|||..:....|     .|.|:.::.:.   
  Rat   128 ELLQNKVPLLGSSTA---CIVVLDRSSHRLHTANLGDSGFLVVRGG-----EVVHRSDEQQH--- 181

  Fly   165 IMASGGWVEFNR-VNGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDVEVLDITEDLEFVLLACD 228
                    .||. ...::|...|.|..     |..:|:....|:: ||::.||      :|.|.|
  Rat   182 --------YFNTPFQLSIAPPEAEGVV-----LSDSPDAADSTSF-DVQLGDI------ILTATD 226

  Fly   229 GIWDVMSNFEVCQFVHKRIRDGME-----PELICEELMNSCLSP-----------DGHTGNVGG- 276
            |::|.|.::.:.|.:.|......|     ...|.|:.......|           |......|| 
  Rat   227 GLFDNMPDYMILQELKKLKNSNYESIQRTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGK 291

  Fly   277 -DNMTVIL 283
             |::||:|
  Rat   292 PDDITVLL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 53/203 (26%)
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 52/201 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.