DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Ppm1b

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001257548.1 Gene:Ppm1b / 24667 RGDID:3374 Length:465 Species:Rattus norvegicus


Alignment Length:317 Identity:136/317 - (42%)
Similarity:187/317 - (58%) Gaps:29/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQA-AFFAVYDGHGGA 64
            ||..|.:|.|.|..|..|....|.|.|.||||||:||||||.::.:|...:. :||||||||.|:
  Rat     1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGS 65

  Fly    65 SVAKYAGKHLHKFITKRPEYR--DNS----------IEVALKKAFLDFDREM-----LQNGSLDE 112
            .||.|...||.:.||...::|  |.|          ::..::..||..|..|     |:|| :|.
  Rat    66 RVANYCSTHLLEHITTNEDFRAADKSGFALEPSVENVKTGIRTGFLKIDEYMRNFSDLRNG-MDR 129

  Fly   113 QTAGCTAIVVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRV 177
              :|.||:.|:|....:|..|.|||||:.|.:|.|...:.||||.:..|.:||..:||.|...||
  Rat   130 --SGSTAVGVMISPTHIYFINCGDSRAVLCRNGQVCFSTQDHKPCNPMEKERIQNAGGSVMIQRV 192

  Fly   178 NGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDV-EVLDITEDLEFVLLACDGIWDVMSNFEVCQ 241
            ||:||:||||||:.||....|.|.||:|:..|:| |:|...|| |||:||||||||||||.|:|:
  Rat   193 NGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEED-EFVVLACDGIWDVMSNEELCE 256

  Fly   242 FVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVCLLHNKSYEDLAVR 298
            ||:.|:....:.|.:|..::::||    |.|:  .|||:::|||..:.....|.||:
  Rat   257 FVNSRLEVSDDLENVCNWVVDTCL----HKGS--RDNMSIVLVCFANAPKVSDEAVK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 124/282 (44%)
Ppm1bNP_001257548.1 PP2Cc 23..295 CDD:238083 124/281 (44%)
PP2C_C 289..365 CDD:285117 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.