DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Ppm1a

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038967714.1 Gene:Ppm1a / 24666 RGDID:3373 Length:455 Species:Rattus norvegicus


Alignment Length:298 Identity:126/298 - (42%)
Similarity:175/298 - (58%) Gaps:21/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQA-AFFAVYDGHGGA 64
            ||..|.:|...|..|.......|.|.|.||||||:||||||.::.||...:. :||||||||.|:
  Rat    74 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGS 138

  Fly    65 SVAKYAGKHLHKFITKRPEYRDN-------SIEVALKKAFLDFDREM--LQNGSLDEQTAGCTAI 120
            .||||..:||...||...:::.:       :::..::..||:.|..|  :.........:|.||:
  Rat   139 QVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAV 203

  Fly   121 VVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSR 185
            .|||..:..|..|.||||.:.|.:..||..:.||||::..|.:||..:||.|...||||:||:||
  Rat   204 GVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSR 268

  Fly   186 ALGDFIYKKNLLKTPEEQIVTAYPDVEVLDI---TEDLEFVLLACDGIWDVMSNFEVCQFVHKRI 247
            |||||.||....|.|.||:|:  |:.||.||   .||.:|::||||||||||.|.|:|.||..|:
  Rat   269 ALGDFDYKCVHGKGPTEQLVS--PEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRL 331

  Fly   248 RDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVC 285
            ....:.|.:|.|::::||    :.|:  .|||:|||:|
  Rat   332 EVTDDLEKVCNEVVDTCL----YKGS--RDNMSVILIC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 120/277 (43%)
Ppm1aXP_038967714.1 PP2Cc 96..364 CDD:238083 120/276 (43%)
PP2C_C 358..436 CDD:400262 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.