DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Pdp2

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_659559.2 Gene:Pdp2 / 246311 RGDID:628812 Length:530 Species:Rattus norvegicus


Alignment Length:295 Identity:70/295 - (23%)
Similarity:106/295 - (35%) Gaps:102/295 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QAAFFAVYDGHGGASVAKYAGKHL----------HKFITKRPEYRDN------------------ 87
            :...|.::|||||.:.|:...:.|          ||.:.:..|..:|                  
  Rat   134 RGTMFGIFDGHGGHACAQAVSERLFYYMAVSLMSHKTLEQMEEAMENMKPLLPILQWLKHPGDSI 198

  Fly    88 ----------------------------SIEVALKKAF--LDFD----------REMLQNGSLDE 112
                                        |.|.||..:|  ||.|          .|:.:|.||..
  Rat   199 YKDITSVHLDHLRVYWQELLDLHMETGLSTEEALMYSFQRLDSDISLEIQAPLEDEVTKNLSLQV 263

  Fly   113 QTAGCTAIVVLIRERRLYCANAGDSRAIACISGMVHA-----LSVDHKPNDAKESKRIMASGGWV 172
            ..:|.||.:..:....|:.|||||.|||..:.|...|     |:.||...:..|..|:.......
  Rat   264 AFSGATACMAHVDGVHLHIANAGDCRAILGVQGDNGAWSCLPLTCDHNAWNEAELSRLKREHPES 328

  Fly   173 E------FNRVNGNLALSRALGDFIYK------KNLLK-------------TPEE----QIVTAY 208
            |      .:|:.|.|...||.||...|      :|:|:             ||..    ..:||.
  Rat   329 EDRTLIIDDRLLGVLLPCRAFGDVQLKWSKELQRNVLERGFDTEALNIYQFTPPHYHTPPYLTAK 393

  Fly   209 PDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFV 243
            |:|....:....:|::||.||:||::.|.:|.:.|
  Rat   394 PEVTYHRLRPQDKFLVLASDGLWDMLDNEDVVRLV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 70/295 (24%)
Pdp2NP_659559.2 PP2Cc 96..516 CDD:214625 70/295 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338447
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.