DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Ppm1l

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_848841.2 Gene:Ppm1l / 242083 MGIID:2139740 Length:360 Species:Mus musculus


Alignment Length:291 Identity:95/291 - (32%)
Similarity:149/291 - (51%) Gaps:38/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYAGKHLHKFITKR-PEY 84
            |:.|....:||.|..|||....:..|.:....:.|.::|||||.:.|:|....|.:.:.:. .:|
Mouse    90 SHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDY 154

  Fly    85 ---RDNSI---EVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDSRAIAC- 142
               ::||:   :..|::..|..|||||:..::....||.|.::.|:.::.|..||.||||.:.| 
Mouse   155 EKDKENSVLTYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCD 219

  Fly   143 ISGMVHALSVDHKPNDAKESKRIMASGGWVEFN---RVNGNLALSRALGDFIYKKNLLKTPEEQI 204
            ..|....||.||||...||.|||..:||::.||   ||.|.||:||:|||:.. |||      .:
Mouse   220 KDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPL-KNL------NV 277

  Fly   205 VTAYPDVEVLDITE-DLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGMEP-----ELICEELMNS 263
            |...||:...|:.: ..||::||.||:||..||.|..:|:.:|:.   ||     .::.:.....
Mouse   278 VIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLD---EPHFGAKSIVLQSFYRG 339

  Fly   264 CLSPDGHTGNVGGDNMTVILVCLLHNKSYED 294
            |           .||:||::|...::...|:
Mouse   340 C-----------PDNITVMVVKFRNSSKTEE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 93/280 (33%)
Ppm1lNP_848841.2 PP2Cc 93..351 CDD:238083 93/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.