DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PPM1E

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_055721.3 Gene:PPM1E / 22843 HGNCID:19322 Length:755 Species:Homo sapiens


Alignment Length:292 Identity:89/292 - (30%)
Similarity:135/292 - (46%) Gaps:37/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CCA-----------NASYRVGSSCMQGWRVDMEDAHTHI------LSLPDDPQAAFFAVYDGHGG 63
            ||:           ...|......::..|..|||.|..|      .:|.|..:.|:|||:|||||
Human   213 CCSWVKDFPLRRRPQLYYETSIHAIKNMRRKMEDKHVCIPDFNMLFNLEDQEEQAYFAVFDGHGG 277

  Fly    64 ASVAKYAGKHLHKFITKRPEYRDNSIEVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLIRERR 128
            ...|.||..|||..:.::..:..:..| ||.:||...|...:|..:.:....|.|.:|..||...
Human   278 VDAAIYASIHLHVNLVRQEMFPHDPAE-ALCRAFRVTDERFVQKAARESLRCGTTGVVTFIRGNM 341

  Fly   129 LYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGG---WVEFNRVNGNLALSRALGDF 190
            |:.|..|||:.:....|....|...|||:...|.:||.|.||   |....||||:|::|||:||.
Human   342 LHVAWVGDSQVMLVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRVNGSLSVSRAIGDA 406

  Fly   191 IYKKNLLKTPEEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHKRIRDGM-EPE 254
            .:|..:....:....       |||.|||  :::|||||.:|.::..|..:.|...:::.. :..
Human   407 EHKPYICGDADSAST-------VLDGTED--YLILACDGFYDTVNPDEAVKVVSDHLKENNGDSS 462

  Fly   255 LICEELMNSCLSPDGHTGNVGGDNMTVILVCL 286
            ::..:|:.|.....      ..||:|||:|.|
Human   463 MVAHKLVASARDAG------SSDNITVIVVFL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 86/273 (32%)
PPM1ENP_055721.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..131
11 X 2 AA tandem repeats of P-E 31..52
PP2Cc 230..488 CDD:238083 86/273 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.