DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Ppm1b

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001152968.1 Gene:Ppm1b / 19043 MGIID:101841 Length:477 Species:Mus musculus


Alignment Length:337 Identity:137/337 - (40%)
Similarity:193/337 - (57%) Gaps:30/337 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDD-PQAAFFAVYDGHGGA 64
            ||..|.:|.|.|..|..|....|.|.|.||||||:||||||.::.:|.. ...:||||||||.|:
Mouse     1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGS 65

  Fly    65 SVAKYAGKHLHKFITKRPEYRD------------NSIEVALKKAFLDFDREM-----LQNGSLDE 112
            .||.|...||.:.||...::|.            .|::..::..||..|..|     |:|| :|.
Mouse    66 RVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNG-MDR 129

  Fly   113 QTAGCTAIVVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRV 177
              :|.||:.|::....:|..|.|||||:.|.:|.|...:.||||.:..|.:||..:||.|...||
Mouse   130 --SGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRV 192

  Fly   178 NGNLALSRALGDFIYKKNLLKTPEEQIVTAYPDV-EVLDITEDLEFVLLACDGIWDVMSNFEVCQ 241
            ||:||:||||||:.||....|.|.||:|:..|:| |::...|| |||:||||||||||||.|:|:
Mouse   193 NGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEED-EFVVLACDGIWDVMSNEELCE 256

  Fly   242 FVHKRIRDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVCLLHNKSYEDLAVRCGGKRKTP 306
            ||..|:....:.|.:|..::::||    |.|:  .|||:|:|||..:.....:.||:...:....
Mouse   257 FVKSRLEVSDDLENVCNWVVDTCL----HKGS--RDNMSVVLVCFSNAPKVSEEAVKRDSELDKH 315

  Fly   307 VET-VGDIQDQS 317
            :|: |.:|..:|
Mouse   316 LESRVEEIMQKS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 122/282 (43%)
Ppm1bNP_001152968.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 8/18 (44%)
PP2Cc 23..295 CDD:238083 122/281 (43%)
PP2C_C 289..365 CDD:369544 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.