DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Ppm1a

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_036013148.1 Gene:Ppm1a / 19042 MGIID:99878 Length:454 Species:Mus musculus


Alignment Length:298 Identity:127/298 - (42%)
Similarity:175/298 - (58%) Gaps:21/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQA-AFFAVYDGHGGA 64
            ||..|.:|...|..|.......|.|.|.||||||:||||||.::.||...:. :||||||||.|:
Mouse    73 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGS 137

  Fly    65 SVAKYAGKHLHKFITKRPEYRDN-------SIEVALKKAFLDFDREM--LQNGSLDEQTAGCTAI 120
            .||||..:||...||...::|.:       :::..::..||:.|..|  :.........:|.||:
Mouse   138 QVAKYCCEHLLDHITNNQDFRGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAV 202

  Fly   121 VVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVEFNRVNGNLALSR 185
            .|||..:..|..|.||||.:.|.:..||..:.||||::..|.:||..:||.|...||||:||:||
Mouse   203 GVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSR 267

  Fly   186 ALGDFIYKKNLLKTPEEQIVTAYPDVEVLDI---TEDLEFVLLACDGIWDVMSNFEVCQFVHKRI 247
            |||||.||....|.|.||:|:  |:.||.||   .||.:|::||||||||||.|.|:|.||..|:
Mouse   268 ALGDFDYKCVHGKGPTEQLVS--PEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRL 330

  Fly   248 RDGMEPELICEELMNSCLSPDGHTGNVGGDNMTVILVC 285
            ....:.|.:|.|::::||    :.|:  .|||:|||:|
Mouse   331 EVTDDLEKVCNEVVDTCL----YKGS--RDNMSVILIC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 121/277 (44%)
Ppm1aXP_036013148.1 PP2Cc 95..363 CDD:238083 121/276 (44%)
PP2C_C 357..435 CDD:400262 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.