DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and fem-2

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_497224.1 Gene:fem-2 / 175217 WormBaseID:WBGene00001412 Length:449 Species:Caenorhabditis elegans


Alignment Length:283 Identity:79/283 - (27%)
Similarity:126/283 - (44%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VGSSCMQGWRVDMEDAHTHILSLP--------DDPQAAFFAVYDGHGGASVAKYAGKHLHKFITK 80
            |....::|.|...||   ..|:.|        :|| .:..||:|||||...::||..||.:...:
 Worm   163 VSGDQLKGQRHKQED---RFLAYPNGQYMDRGEDP-ISVLAVFDGHGGHECSQYAAGHLWETWLE 223

  Fly    81 RPEYRD--NSIEVALKKAFLDFDREMLQNGSLDEQTAGCTAIVVLI--RERRLYCANAGDSRAIA 141
            ..:.||  :|:|..|:|:....|..|......:....|.||:...|  .::.:..|..|||....
 Worm   224 VRKSRDPSDSLEDQLRKSLELLDERMTVRSVKECWKGGSTAVCCAIDMDQKLMALAWLGDSPGYV 288

  Fly   142 CISGMVHALSVDHKPNDAKESKRIMASGGWV-----EFNRVNGNLALSRALGDFIYKKNLLKTPE 201
            ..:.....|:..|.|:|.:|::|:..:||.:     |. ||||.|.|:|||||         .|.
 Worm   289 MSNIEFRQLTRGHSPSDEREARRVEEAGGQLFVIGGEL-RVNGVLNLTRALGD---------VPG 343

  Fly   202 EQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQFVHK-----RIRDGME-PELICEEL 260
            ..:::..|:...:.|......||||||||.||.:..::.|.|..     .:.|..| ...||.:.
 Worm   344 RPMISNEPETCQVPIESSDYLVLLACDGISDVFNERDLYQLVEAFANDYPVEDYAELSRFICTKA 408

  Fly   261 MNSCLSPDGHTGNVGGDNMTVIL 283
            :.:        |:  .||::|::
 Worm   409 IEA--------GS--ADNVSVVI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 79/283 (28%)
fem-2NP_497224.1 PP2C 161..417 CDD:278884 77/277 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.