DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and PPM1M

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_653242.3 Gene:PPM1M / 132160 HGNCID:26506 Length:459 Species:Homo sapiens


Alignment Length:390 Identity:89/390 - (22%)
Similarity:149/390 - (38%) Gaps:128/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDD-PQAAFFAVYDGHGGASVAKYAGKHLH 75
            :|.|.|       |..|::  |.:.......:...|:: ....::|::|||||.:.|..|...||
Human    86 EDQAAC-------GKLCIR--RCEFGAEEEWLTLCPEEFLTGHYWALFDGHGGPAAAILAANTLH 141

  Fly    76 ---------------------------------KFITKRPEYRDNSIEVALKKAFLDFD----RE 103
                                             :|:.::....::.:..||:.||.:.|    ||
Human   142 SCLRRQLEAVVEGLVATQPPMHLNGRCICPSDPQFVEEKGIRAEDLVIGALESAFQECDEVIGRE 206

  Fly   104 MLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMA- 167
            :..:|    |..||||:|.:..:.:||.|||||||||......:..||.:..|...::..:.:| 
Human   207 LEASG----QMGGCTALVAVSLQGKLYMANAGDSRAILVRRDEIRPLSFEFTPETERQRIQQLAF 267

  Fly   168 ----------------------------------SGGWVEFNRVN-------------------G 179
                                              ..|| .:.||.                   |
Human   268 VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGW-SYKRVEKSDLKYPLIHGQGRQARLLG 331

  Fly   180 NLALSRALGD---------FIYKKNLLKTPEEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMS 235
            .||:||.|||         ...|..||..|:..::    ||:.|::.|| :.|::|.||:|||:|
Human   332 TLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVL----DVDQLELQED-DVVVMATDGLWDVLS 391

  Fly   236 NFEVCQFVHKRIRDGMEP----ELICEELMNSCLSPDG---HTGNVGGDNMTVILVCLLHNKSYE 293
            |.:|...|...:....|.    ..:.:.|::|....:.   ..|.|..|:::|.:: .||::..|
Human   392 NEQVAWLVRSFLPGNQEDPHRFSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVI-PLHSQGQE 455

  Fly   294  293
            Human   456  455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 83/371 (22%)
PPM1MNP_653242.3 PP2Cc 118..449 CDD:238083 79/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.