DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and Pp2d1

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_775625.1 Gene:Pp2d1 / 110332 MGIID:3612067 Length:620 Species:Mus musculus


Alignment Length:327 Identity:68/327 - (20%)
Similarity:118/327 - (36%) Gaps:109/327 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVAKYA 70
            |..:..|..|.|:|.:        ..|:.:.....|.:....|.....||.::|.|.|.:.|..|
Mouse   166 SNHLMIKGIAICSNNN--------SAWKAEPNCKFTVVNDFGDKANVCFFGLFDSHYGYAAADLA 222

  Fly    71 GKH-----LHK------------------------------------------FITKRPEYRDNS 88
            .|.     ||:                                          |.|.|.||.|. 
Mouse   223 SKEFQVLLLHQLSIQDPSYQMTAEQKQLINSFDTVFREEYRAREEAFSSTYKTFRTSRREYEDT- 286

  Fly    89 IEVALKKAFLDFDR--EMLQNGSLDEQTAGCTAIVVLIR------------ERR----------- 128
             ..|..|||...||  .:.:|.:...:.:||:|:..::.            |:.           
Mouse   287 -HKAFAKAFWRMDRLLRLGRNETSRVRWSGCSALTCILEGGIKNPHANKDWEKTYQQGSTSLPFQ 350

  Fly   129 ---------LYCANAGDSRAIACISGMVHALSVDHKPNDAKESKRIMASGGWVE----FNRVNGN 180
                     |:.||||:.:|:.|.:|....|:.:|...:.||.:|::.|...:.    :..::|:
Mouse   351 KTPQIISGVLHLANAGNVQAVLCRNGKGFCLTKEHSTRNTKERRRVLYSEAVISSDDPYGLLDGH 415

  Fly   181 LALSRAL---GDFIYKKNLLKTPEEQIVTAYPDVEVLDITEDL-EFVLLACDGIWDVMSNFEVCQ 241
            :..:|.|   |:...||:::..|:...|.          .:|| :|::||.:|:|.|:...||..
Mouse   416 IKTTRGLGFHGNLRLKKSIIPAPQTISVP----------IDDLCQFLILATNGLWQVLDKKEVTA 470

  Fly   242 FV 243
            .|
Mouse   471 LV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 63/311 (20%)
Pp2d1NP_775625.1 PP2Cc 187..472 CDD:238083 61/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834868
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.