DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and TAB1

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_006107.1 Gene:TAB1 / 10454 HGNCID:18157 Length:504 Species:Homo sapiens


Alignment Length:413 Identity:84/413 - (20%)
Similarity:151/413 - (36%) Gaps:99/413 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QTLSEPVTTKDTACCANASYRVGSSCMQGWRVDMEDAHTHILSLPDDPQAAF--------FAVYD 59
            |:..:|..|.|...|..:.  |||:..:.:..|.:...:|   .|:|....|        :.|::
Human    10 QSEQQPSWTDDLPLCHLSG--VGSASNRSYSADGKGTESH---PPEDSWLKFRSENNCFLYGVFN 69

  Fly    60 GHGGASVAKYAGKHLHKFI---TKRPEYRDNSIEVALKKAFLDFDREMLQN--------GSLDEQ 113
            |:.|..|..:..:.|...:   ....|:.:..:...|.:||...:|..|::        .||..|
Human    70 GYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQ 134

  Fly   114 ----------------------------TAGCTAIVVLIRERRLYCANAGDSRAIAC---ISGM- 146
                                        :.|..|:|.::...:||.||.|.:||:.|   :.|: 
Human   135 LPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQ 199

  Fly   147 VHALSVDHKPNDAKESKRIMASG---GWVEFNRVNGNLALSRALGDFIYKK-----NLLKTPEEQ 203
            |..|:|||...:..|..|:...|   |.::...:......:|.:||:..|.     :||...:.:
Human   200 VTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSK 264

  Fly   204 IVTAYPDV---EVLD-ITEDLEFVLLACDGIWDVM--------SNFEVCQFVHKRIRDGMEPELI 256
            .:.|.|::   :.|| :|   .|::|..:|::..:        :|.|:...:..........:.:
Human   265 PIIAEPEIHGAQPLDGVT---GFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAV 326

  Fly   257 CEELMNSCLSPDGHTGNVGGDNMTVILVCLLHNKSYED--LAVRCGG--------KRKTPVETVG 311
            .:.:::........|...||:...   .|..|    ||  |.||..|        ...:|....|
Human   327 AQAVVDRVKRIHSDTFASGGERAR---FCPRH----EDMTLLVRNFGYPLGEMSQPTPSPAPAAG 384

  Fly   312 DIQDQSVKVVTPCSQGSSGSSTS 334
               .:...|..|.|...|.|.||
Human   385 ---GRVYPVSVPYSSAQSTSKTS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 62/334 (19%)
TAB1NP_006107.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/11 (36%)
PP2C 69..334 CDD:395385 50/267 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..478
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.