DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppm1 and pdp2

DIOPT Version :9

Sequence 1:NP_612039.1 Gene:Ppm1 / 38071 FlyBaseID:FBgn0035143 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002942040.2 Gene:pdp2 / 100489227 XenbaseID:XB-GENE-480918 Length:536 Species:Xenopus tropicalis


Alignment Length:345 Identity:85/345 - (24%)
Similarity:130/345 - (37%) Gaps:131/345 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RVGSSCMQGWRVDMEDAHTHILSLPDDPQAAFFAVYDGHGGASVA-------------------- 67
            |..::|:|        .:.|:           |.|:|||.|::.|                    
 Frog   128 RSAATCLQ--------TNGHL-----------FGVFDGHAGSACAQSVSERLFYYIAVSLMSQKT 173

  Fly    68 ----KYAGKHL---------HKFITKRPE-YR--------------------DN----SIEVALK 94
                ::|.:||         ||.  |... ||                    ||    |:|.|:.
 Frog   174 LEDIEFASEHLKPMLPILQWHKH--KNDHLYREVASLYVDHLRVYWQELINLDNESGMSLEDAMV 236

  Fly    95 KAF--LDFD----------REMLQNGSLDEQTAGCTAIVVLIRERRLYCANAGDSRAIACI---S 144
            .||  ||.|          .|.|:|.:|....:|.||.|..|....|:.||:||.|||..:   :
 Frog   237 YAFQRLDSDISLEAQVPTNNEFLRNLTLQVAFSGATACVSHIDGIHLHIANSGDCRAILGVQDDN 301

  Fly   145 GMVHA--LSVDHKPNDAKESKRIMA------SGGWVEFNRVNGNLALSRALGDFIYK------KN 195
            |...|  |:.||...:..|.:|:.|      ....|..||:.|.|...||.||.|:|      |:
 Frog   302 GAWSAVPLTADHNAFNKAELQRLNAEHPPSEKDTLVTDNRLLGILMPFRAFGDVIFKWSRELQKS 366

  Fly   196 LL-------------------KTPEEQIVTAYPDVEVLDITEDLEFVLLACDGIWDVMSNFEVCQ 241
            :|                   .||  ..::|.|:|....:....:|:::|.||:||::.|.:|.:
 Frog   367 VLLNACDLEPLNIYQYSPSNYHTP--PYLSAEPEVTYHKLRPQDKFLIMASDGLWDMLENEQVVK 429

  Fly   242 FVHKRIRDG--MEPELICEE 259
            .|...:.:.  .||||..::
 Frog   430 LVANHLLENFLQEPELSAQK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppm1NP_612039.1 PP2Cc 22..286 CDD:238083 85/345 (25%)
pdp2XP_002942040.2 PP2Cc 113..521 CDD:238083 85/345 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.