DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and AT1G73450

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:NP_177487.2 Gene:AT1G73450 / 843680 AraportID:AT1G73450 Length:1152 Species:Arabidopsis thaliana


Alignment Length:531 Identity:137/531 - (25%)
Similarity:228/531 - (42%) Gaps:117/531 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DGTRHQEQQQQQLQQQQQQHILRQPAT---SASTSSVAAAATSKRKRQTDCDCGCVDSYNSSHGP 112
            ||.....:..:.|....::.:.|...|   ||||::....||.::|          .|.:||...
plant   683 DGQLMHAESSKSLWSGNRETVTRDRNTELLSASTATDDMVATWRQK----------SSDSSSSRS 737

  Fly   113 PVQQDSSAAAGAGSVGSKAGSGPGPDGIGPISSLKTAHTKVA--------TSGGHANTQPPSK-- 167
            .|::::  |....||.|...|         :|:......|.|        ...|||......:  
plant   738 SVKENN--ATSIKSVNSSPSS---------LSNYARGERKHAEKENDSSEREDGHATALDDEEAV 791

  Fly   168 ------RSSSGADGDYQLVQHEVLYS-------------------LSAEYEVLEFLGRGTFGQVV 207
                  |.....:.:::....::::.                   ::..|.|.|:||...|.:.:
plant   792 AVQEQVRQIKAQEEEFETFDLKIVHRKNRTGFEEEKNFNVVLNSVIAGRYHVTEYLGSAAFSKAI 856

  Fly   208 KCWKRGTSEIVAIKILKNHPSYARQGQIEVSILSRLSQEN-ADEFNFVRAFECFQHKNHTCLVFE 271
            :.....|...|.|||:||:..:..|...|:.:|..:::.: ||:::.:|.::.|.::.|..:|.|
plant   857 QAHDLQTGMDVCIKIIKNNKDFFDQSLDEIKLLKYVNKHDPADKYHLLRLYDYFYYREHLLIVCE 921

  Fly   272 MLEQNLYDFLKQNKFSPLPLKYIRPILE----QVLTALLKLKQLGLIHADLKPENIMLVDPVRQP 332
            :|:.|||:|.|.|:.|...:.:..|.|:    |.|.:|..|..|||||.|||||||::....|  
plant   922 LLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLESLQFLHGLGLIHCDLKPENILVKSYSR-- 984

  Fly   333 YRVKVIDFGSASHVSKTVCNTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVVAELFLGWPLYPGS 397
            ..:||||.||:...:..:| :|:|||.|||||:|||||:.:.||:|||||::|||..|..|:...
plant   985 CEIKVIDLGSSCFETDHLC-SYVQSRSYRAPEVILGLPYDKKIDVWSLGCILAELCTGNVLFQND 1048

  Fly   398 SEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRDVDSTYPFWRLKTTEEHEAETNTKSKEARKYI 462
            |....:..:....|.....||.....:.|:|.::          :...|...|:|.         
plant  1049 SPASLLARVMGIVGSFDNEMLTKGRDSHKYFTKN----------RMLYERNQESNR--------- 1094

  Fly   463 FNCLDDIGQVNVPTDLEGGQLLAEKTDRRE--------FIDLLKRMLTIDQERRLTPAEALNHSF 519
                           ||  .|:.::|..|.        |.|.:..:|.|:.::|.:.||||.|.:
plant  1095 ---------------LE--YLIPKRTSLRHRLPMGDQGFTDFVAHLLEINPKKRPSAAEALKHPW 1142

  Fly   520 TRLTHLVDYVY 530
                  :.|.|
plant  1143 ------LSYPY 1147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 107/340 (31%)
PHA03378 <1080..1327 CDD:223065
AT1G73450NP_177487.2 PKc_DYRK_like 841..1143 CDD:271035 107/346 (31%)
S_TKc 841..1143 CDD:214567 107/346 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24058
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.