DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and dyrk4

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:XP_009296230.1 Gene:dyrk4 / 564976 ZFINID:ZDB-GENE-091015-3 Length:644 Species:Danio rerio


Alignment Length:370 Identity:136/370 - (36%)
Similarity:197/370 - (53%) Gaps:50/370 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PSKRSSSGADGDYQLVQHEVLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSY 229
            |.........|.|..|.|:   .:...|||||.:|:|:||||:||....|:|.|||||::|...:
Zfish   198 PQNAGYDDEHGSYLKVLHD---HIGYRYEVLEVIGKGSFGQVLKCLDHKTNETVAIKIIRNKKRF 259

  Fly   230 ARQGQIEVSILSRLSQENADE-FNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKY 293
            ..|..:|:.||..:.:.:.|. .|.:...|.|..:||.|:.||:|..|||:.:|:|.|....|..
Zfish   260 HHQALVELKILDAVRRRDRDNCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLGL 324

  Fly   294 IRPILEQVLTALLKLKQLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCNTYLQSR 358
            ||.....:|..|..|.:..:||.|||||||:|..  |....:||:||||:.:..:.| .||:|||
Zfish   325 IRRFAHSLLKCLQMLHKEKIIHCDLKPENILLSQ--RGQGNIKVVDFGSSCYEQQRV-YTYIQSR 386

  Fly   359 YYRAPEIILGLPFCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASK 423
            :||:||:|||.|:..|||||||||::|||:.|:||:||.||.:||..|.:..|||....:.:||:
Zfish   387 FYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEIMGLPPNDFVQTASR 451

  Fly   424 TSKFF-----YRDVDSTYPFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVPTDLEGGQL 483
            ...||     .|::                  ||:|.|:.|               |:..:...:
Zfish   452 RRLFFDSKGNPRNI------------------TNSKGKKRR---------------PSSKDLASV 483

  Fly   484 LAEKTDRREFIDLLKRMLTIDQERRLTPAEALNHSFT---RLTHL 525
            |  ||:...|:|.::|.|..|..:|:||.||:.|.:.   ||..|
Zfish   484 L--KTNDPLFLDFIQRCLVWDPTKRMTPDEAMQHEWITEGRLNRL 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 128/333 (38%)
PHA03378 <1080..1327 CDD:223065
dyrk4XP_009296230.1 PKc_DYRK4 178..518 CDD:271127 133/360 (37%)
S_TKc 222..518 CDD:214567 128/333 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R968
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.