DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and Dyrk4

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:XP_038964750.1 Gene:Dyrk4 / 312721 RGDID:1306800 Length:649 Species:Rattus norvegicus


Alignment Length:357 Identity:134/357 - (37%)
Similarity:193/357 - (54%) Gaps:41/357 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SKRSSSGADGDYQLVQHEVLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYA 230
            ||.|.....|.|..|.|:   .::..||||:.:|:|:||||.||.....:|:||:||::|...:.
  Rat   213 SKTSFDDEHGSYVKVLHD---HIAYRYEVLDMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFH 274

  Fly   231 RQGQIEVSILSRLSQENADE-FNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYI 294
            .|..:|:.||..|.:::.|. .|.|...:.|..:||.|:.||:|..|||:.:|.|.|....|..:
  Rat   275 HQALVELKILEALRRKDKDNTHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFQGFSLSIV 339

  Fly   295 RPILEQVLTALLKLKQLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCNTYLQSRY 359
            |.....||..|..|....:||.|||||||:|..  |....||||||||:.:..:.| .||:|||:
  Rat   340 RRFTLSVLKCLQMLYVEKIIHCDLKPENIVLYH--RGQVTVKVIDFGSSCYEHQKV-YTYIQSRF 401

  Fly   360 YRAPEIILGLPFCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKT 424
            ||:||:|||.|:..|||||||||::|||:.|:||:||.:|.:|:..|.:..|||..|::.:|::.
  Rat   402 YRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPTHLIQTATRR 466

  Fly   425 SKFFYRDVDSTYPFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVPT--DLEGGQLLAEK 487
            ..||                         .||...|.|.|   :.|:...|.  ||.    :..|
  Rat   467 QIFF-------------------------DSKGLPKNITN---NRGEKRYPNSKDLP----MVVK 499

  Fly   488 TDRREFIDLLKRMLTIDQERRLTPAEALNHSF 519
            |....|:|.|:|.|..:...|:||.:||.|::
  Rat   500 TYDSSFLDFLRRCLVWEPSLRMTPDQALKHAW 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 127/331 (38%)
PHA03378 <1080..1327 CDD:223065
Dyrk4XP_038964750.1 PKc_DYRK4 192..532 CDD:271127 134/357 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.