DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and Clk1

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:NP_001100383.2 Gene:Clk1 / 301434 RGDID:1311469 Length:483 Species:Rattus norvegicus


Alignment Length:458 Identity:134/458 - (29%)
Similarity:215/458 - (46%) Gaps:96/458 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VDSYNSSH------------GPPVQQDSSAAAGAGSVGSKAGSGPGPDGIGPISSLKTA-----H 150
            ||.|.:.:            |...|..||.::|      ::|.          ||.|:.     |
  Rat    73 VDEYRNDYMTYEPGYPYGEPGSRYQNHSSKSSG------RSGR----------SSYKSKHRSHHH 121

  Fly   151 TKVATSGGHANTQPPSKRSSSGADGDYQLVQHEVLYS---LSAEYEVLEFLGRGTFGQVVKC--W 210
            |....|.|.::.:   |||.|..|.:   ..|.:..|   |||.||:::.||.|.||:||:|  .
  Rat   122 TSHRRSHGKSHRR---KRSRSVEDDE---EGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDH 180

  Fly   211 KRGTSEIVAIKILKNHPSYARQGQIEVSILSRLSQENADE----FNFVRAFECFQHKNHTCLVFE 271
            |.| ...||:||:||...|....|.|:.:|..|   ||.:    |..|:..|.|:|:.|.|:|||
  Rat   181 KVG-GRHVAVKIVKNVDRYCEAAQSEIQVLEHL---NATDPHSTFRCVQMLEWFEHRGHICIVFE 241

  Fly   272 MLEQNLYDFLKQNKFSPLPLKYIRPILEQVLTALLKLKQLGLIHADLKPENIMLV-DPVRQPYR- 334
            :|..:.|||:|:|.|.|..:.:||.:..|:..::..|....|.|.|||||||:.| ....:.|. 
  Rat   242 LLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNP 306

  Fly   335 -------------VKVIDFGSASHVSKTVCNTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVVAE 386
                         :||:|||||::..:. .:|.:.:|:|||||:||.|.:.:..|:||:||::.|
  Rat   307 KMKRDERTIVNPDIKVVDFGSATYDDEH-HSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIE 370

  Fly   387 LFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRDVDSTYPFWRLKTTEEHEAET 451
            .:||:.::|.....:.:..:.:..|...:||:....|.:.|.:..:|     |     :||.:  
  Rat   371 YYLGFTVFPTHDSREHLAMMERILGPLPKHMIEKTRKRTYFHHDRLD-----W-----DEHSS-- 423

  Fly   452 NTKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRREFIDLLKRMLTIDQERRLTPAEALN 516
                  |.:|:......:.:.          :|::..:.....||:.:||..|..:|:|..|||.
  Rat   424 ------AGRYVSRRCKPLKEF----------MLSQDAEHELLFDLIGKMLEYDPAKRITLKEALK 472

  Fly   517 HSF 519
            |.|
  Rat   473 HPF 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 108/349 (31%)
PHA03378 <1080..1327 CDD:223065
Clk1NP_001100383.2 PKc_CLK1_4 147..476 CDD:271115 113/362 (31%)
S_TKc 160..476 CDD:214567 108/349 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.