DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and pom2

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:NP_593081.2 Gene:pom2 / 2542326 PomBaseID:SPAC16C9.07 Length:836 Species:Schizosaccharomyces pombe


Alignment Length:348 Identity:128/348 - (36%)
Similarity:200/348 - (57%) Gaps:39/348 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 DGDYQLVQHE-VLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEV 237
            :|||:.:|.: :||    .||:::.:|:|:||||:||......::||||::||...:..|..:||
pombe   503 NGDYKAIQGDHLLY----RYEIIDTVGKGSFGQVLKCIDHKRGQVVAIKVIKNRQKFHGQTLVEV 563

  Fly   238 SILSRLSQ-ENADEFNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILEQV 301
            .||.||.: :.||:.|.:|....|..:.|.|:|.|:|..||:|.:::|.:..|||..::....|.
pombe   564 GILKRLCEADPADKNNVIRYLSHFDFRGHLCIVTELLGSNLFDVIRENNYKGLPLIVVKSFALQG 628

  Fly   302 LTALLKLKQLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCNTYLQSRYYRAPEII 366
            |.||..|:...:||.||||||::|..|::.  |:|:|||||:...::.| .||||||:|||||||
pombe   629 LQALRLLQGQNIIHCDLKPENLLLSHPLKA--RIKLIDFGSSCFYNEKV-YTYLQSRFYRAPEII 690

  Fly   367 LGLPFCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRD 431
            |||.:.:.||:||.||::||||.|.||:||.:|.:|:.||.:..|.|...::.:::: ||.::..
pombe   691 LGLEYGKEIDIWSFGCILAELFTGVPLFPGGNETEQLGYIMEVLGPPPMALIRNSTR-SKAYFDS 754

  Fly   432 VDSTYPFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRREFIDL 496
            ....:|.     |:.|                      .::.||:.....|||  .|.:..|:|.
pombe   755 EGKPHPI-----TDSH----------------------NRLLVPSTRTFSQLL--NTKQASFLDF 790

  Fly   497 LKRMLTIDQERRLTPAEALNHSF 519
            |.:.|..|.:.|:|...||.|.|
pombe   791 LSKCLKWDPKDRITVDSALQHEF 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 122/329 (37%)
PHA03378 <1080..1327 CDD:223065
pom2NP_593081.2 PKc_DYRK 504..814 CDD:271112 128/347 (37%)
S_TKc 518..814 CDD:214567 122/329 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R968
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.