DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and C36B7.2

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:NP_509198.2 Gene:C36B7.2 / 183254 WormBaseID:WBGene00016465 Length:446 Species:Caenorhabditis elegans


Alignment Length:353 Identity:85/353 - (24%)
Similarity:161/353 - (45%) Gaps:42/353 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 YQLVQHEVLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKIL-KNHPSYARQGQIEVSIL 240
            |::.:.|   .:...|.:.:.:|:|.:|.|.:.....|.:.|||::: |..|...|:.:: :..:
 Worm    98 YKMKKDE---HIGYRYTIDKVIGQGCYGVVGEATDGKTKQKVAIRMVSKLAPRIYRETEM-IMYI 158

  Fly   241 SRLSQENADEFNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILEQVLTAL 305
            |.:..::.  |:.||..:....:....:|.::.:.::..::|::..:.:.|:.:..:..::|..|
 Worm   159 SSIDPDHT--FDCVRMLDYNVFRGFHYVVTDLFDTSVKKYIKEHHPNGIALENVAAMGRKILKGL 221

  Fly   306 LKLKQLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCNTYLQSRYYRAPEIILGLP 370
            :.|.:..::|.|||||||||  .:..|..||:.|||.:........:...||.:|||||..:...
 Worm   222 VFLHEHNIVHGDLKPENIML--NLANPNDVKLGDFGLSRFAKPYHDHVQCQSMFYRAPEAFVRGR 284

  Fly   371 FCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRDVDST 435
            :..|.||||.||.|||:..|.....|.:..||...:.:...:|.....::       ||.:.   
 Worm   285 YNGATDMWSFGCTVAEMVSGKIFLAGDNCDDQFYLMQEVINIPPPVFFDT-------FYTNY--- 339

  Fly   436 YPFWRLKTTEEHEAETN---------TKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRR 491
            |.|..||...:|...|:         ||:.:.||             :|.....|.... ||:::
 Worm   340 YFFSTLKEAPKHIVITDHGPIVSFIYTKAADHRK-------------IPGATPIGSFFT-KTEQK 390

  Fly   492 EFIDLLKRMLTIDQERRLTPAEALNHSF 519
            .|.:.:.::.......|:|..:||:|.|
 Worm   391 PFNNFILKVFKWMPASRITAKQALDHPF 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 83/338 (25%)
PHA03378 <1080..1327 CDD:223065
C36B7.2NP_509198.2 PKc_like 98..419 CDD:389743 85/353 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.