DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and HIPK4

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:XP_006723099.1 Gene:HIPK4 / 147746 HGNCID:19007 Length:619 Species:Homo sapiens


Alignment Length:349 Identity:174/349 - (49%)
Similarity:235/349 - (67%) Gaps:22/349 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 YEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILSRLSQENADEFNFVRA 256
            |:::|.||:||||:|.|.|:|.|.|:||||||||.....|..:.|:.:|..:...:.:|.:.:|.
Human    11 YDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRNRIIKNELKLLHCMRGLDPEEAHVIRF 75

  Fly   257 FECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILEQVLTALLKLKQLGLIHADLKPE 321
            .|.|.......||||:|||||::|.|:|.|:|||.::||.:..||||||.:||:|.:||||||||
Human    76 LEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIRTVTLQVLTALARLKELAIIHADLKPE 140

  Fly   322 NIMLVDPVRQPYRVKVIDFGSASHVSKT--VCNTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVV 384
            ||||||..|.|:|||||||||||..|:.  |...|:|||:||||||:|||||||.:|:||||||:
Human   141 NIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKEPYIQSRFYRAPEILLGLPFCEKVDVWSLGCVM 205

  Fly   385 AELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRD--VDSTYPFWRLKTTEEH 447
            |||.||||||||::|:||:|||.:|||||..|:|::|.|...||.|:  .|:..| |:||::.::
Human   206 AELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLHAACKAHHFFKRNPHPDAANP-WQLKSSADY 269

  Fly   448 EAETNTKSKEARKYIFNCLDDIGQVNVPTDLEGG-----------QLLAEKTDRREFIDLLKRML 501
            .|||..:..|.|||:...||.|..||      ||           :.|||..|.:..::|:||||
Human   270 LAETKVRPLERRKYMLKSLDQIETVN------GGSVASRLTFPDREALAEHADLKSMVELIKRML 328

  Fly   502 TIDQERRLTPAEALNHSFTRLTHL 525
            |.:...|::|:.||.|.|..:..|
Human   329 TWESHERISPSAALRHPFVSMQQL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 172/342 (50%)
PHA03378 <1080..1327 CDD:223065
HIPK4XP_006723099.1 PKc_like 11..347 CDD:304357 172/342 (50%)
S_TKc 11..347 CDD:214567 172/342 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D38932at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24058
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.