DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hipk and Dyrk4

DIOPT Version :9

Sequence 1:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster
Sequence 2:XP_011239406.1 Gene:Dyrk4 / 101320 MGIID:1330292 Length:685 Species:Mus musculus


Alignment Length:357 Identity:135/357 - (37%)
Similarity:190/357 - (53%) Gaps:41/357 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SKRSSSGADGDYQLVQHEVLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYA 230
            ||.|.....|.|..|.|:   .::..|||||.:|:|:||||.||.....:|:||:||::|...:.
Mouse   249 SKTSFDDEHGSYMKVLHD---HIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFH 310

  Fly   231 RQGQIEVSILSRLSQENAD-EFNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYI 294
            .|..:|:.||..|.:::.| ..|.|...:.|..:||.|:.||:|..|||:.:|.|.|....|..:
Mouse   311 HQALVELKILEALRRKDKDNNHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFHGFNLSIV 375

  Fly   295 RPILEQVLTALLKLKQLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKTVCNTYLQSRY 359
            |.....:|..|..|....:||.|||||||:|..  |....||||||||:.:..:.| .||:|||:
Mouse   376 RRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQ--RGQVTVKVIDFGSSCYEHQKV-YTYIQSRF 437

  Fly   360 YRAPEIILGLPFCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKT 424
            ||:||:|||.|:..|||||||||::|||:.|:||:||.:|.:|:..|.:..|||..|...:||:.
Mouse   438 YRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAHFTQTASRR 502

  Fly   425 SKFFYRDVDSTYPFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVP--TDLEGGQLLAEK 487
            ..||                         .||...|.|.|   :.|....|  .||    .:..|
Mouse   503 QVFF-------------------------DSKGLPKNINN---NRGGKRYPDSKDL----TMVVK 535

  Fly   488 TDRREFIDLLKRMLTIDQERRLTPAEALNHSF 519
            |....|:|.|:|.|..:...|:||.:||.|::
Mouse   536 TYDSSFLDFLRRCLVWEPSLRMTPEQALKHAW 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 128/331 (39%)
PHA03378 <1080..1327 CDD:223065
Dyrk4XP_011239406.1 PKc_DYRK4 228..568 CDD:271127 135/357 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R968
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.