DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and CPR8

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:39/147 - (26%)
Similarity:68/147 - (46%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITVELYWKHAPNTCRNFAE---------LSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY 87
            ||::||....|.|...|.:         .||..|.....|.:|:.:..|:|...:.:......:.
Yeast    69 ITIDLYGTMVPKTVMTFCQYVDSVKDRLASRHSYSPERDFDKILPNGAIEGSSVSSSSIEETEML 133

  Fly    88 GSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGM-EVVKRI 151
            ..:..:|.| .|.|...|.:||..   |..|.:|.|..:.|. |:|:..:||:|..|: :::.::
Yeast   134 APKLPEENH-SLIHDRPGRVSMIK---DDKGLKFIIETSETP-LEGESVVFGQVTAGLKDLMDKL 193

  Fly   152 GMVETDKNDRPVDPLRI 168
            ..|:||:|.:|..|:.|
Yeast   194 ANVKTDENGKPEQPITI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 39/147 (27%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 38/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.