DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and CPR1

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_010439.1 Gene:CPR1 / 851733 SGDID:S000002562 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:71/152 - (46%)
Similarity:91/152 - (59%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MGEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHRIIRDFMIQGGDPT-GTGRGGASIYGS 89
            :|.:..:||....|.|..||..|  ..:|: |....|||:|.|||:||||.| |.|.||.||||.
Yeast    15 IGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGG 79

  Fly    90 EFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMV 154
            :|.|| :....|...|:|||||:||:|||||||||..|..||||||.:||.|..|.::||:   |
Yeast    80 KFPDE-NFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKK---V 140

  Fly   155 ETDKNDRPVDPLRIIKAKVEKL 176
            |:..:.......||:.||..:|
Yeast   141 ESLGSPSGATKARIVVAKSGEL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 68/144 (47%)
CPR1NP_010439.1 cyclophilin_ABH_like 2..160 CDD:238907 70/148 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61277
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.