DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and CPR4

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:55/176 - (31%)
Similarity:84/176 - (47%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HFVTLETSMGE--ITVELYWKHAPNTCRNFAELSR--------------RGY-YNNVVFHRIIRD 68
            :|..:..||.|  :|.|||....|.|..|||.|:.              ..| |.....:::..:
Yeast    55 YFDPVSKSMKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPNDIHTYSYRKTKINKVYPN 119

  Fly    69 FMIQGGDPTGTGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAP--TQWL 131
            ..|||| ......|..::||.:|.|| :..|:|.....|:||..|||:|.|:|.||...  .:.|
Yeast   120 KYIQGG-VVAPDVGPFTVYGPKFDDE-NFYLKHDRPERLAMAYFGPDSNTSEFIITTKADGNEEL 182

  Fly   132 DGKHTIFGRVYTGM-EVVKRIGMVETDKNDRPVDPLRIIKAKVEKL 176
            |||..:||::.:|: :::..|...|||:..:|...||.:...:|.|
Yeast   183 DGKSVVFGQITSGLDQLMDAIQYTETDEYGKPQHELRFLYFVLEIL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 52/165 (32%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 47/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.