DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and AT1G01940

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_171696.2 Gene:AT1G01940 / 839309 AraportID:AT1G01940 Length:160 Species:Arabidopsis thaliana


Alignment Length:151 Identity:73/151 - (48%)
Similarity:100/151 - (66%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY 87
            |||.|::|:|..|::....|.:..||..|...|||:..:|||.|:.||||||||.|||:||.||:
plant     3 VTLHTNLGDIKCEIFCDEVPKSAENFLALCASGYYDGTIFHRNIKGFMIQGGDPKGTGKGGTSIW 67

  Fly    88 GSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIG 152
            |.:|.||:...|:|...|:||||||||:|||||||||.|....|:|.:||||:|..|.||:..:.
plant    68 GKKFNDEIRDSLKHNARGMLSMANSGPNTNGSQFFITYAKQPHLNGLYTIFGKVIHGFEVLDIME 132

  Fly   153 MVETDKNDRPVDPLRIIKAKV 173
            ..:|...|||:..:|:.:..:
plant   133 KTQTGPGDRPLAEIRLNRVTI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 72/145 (50%)
AT1G01940NP_171696.2 Cyclophilin_PPIL3_like 1..153 CDD:238909 73/149 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.