DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and PUB49

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_201554.1 Gene:PUB49 / 836889 AraportID:AT5G67530 Length:595 Species:Arabidopsis thaliana


Alignment Length:152 Identity:77/152 - (50%)
Similarity:104/152 - (68%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FVTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASI 86
            :|..:|:.|::.:||:...||..|.||..|..|||||.|.|||.||:||||||||||||:||.||
plant   345 YVQFQTTHGDLNIELHCDIAPRACENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGKGGESI 409

  Fly    87 YGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRI 151
            :|..|.||.:..|.|:|.|::|||||||.|||||||:.......|:.|||:||.|..|:..:..:
plant   410 WGKPFKDEPNSKLLHSGRGVVSMANSGPHTNGSQFFVLYKSATHLNYKHTVFGGVVGGLATLAAM 474

  Fly   152 GMVETDKNDRPVDPLRIIKAKV 173
            ..|..|::|||::.::||:|.|
plant   475 ENVPVDESDRPLEEIKIIEASV 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 73/145 (50%)
PUB49NP_201554.1 RING 39..101 CDD:302633
cyclophilin_RING 345..502 CDD:238904 77/152 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.