DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and PPIAL4E

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001137504.2 Gene:PPIAL4E / 730262 HGNCID:33997 Length:164 Species:Homo sapiens


Alignment Length:135 Identity:68/135 - (50%)
Similarity:86/135 - (63%) Gaps:19/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MGEITVELYWKHAPNTCRNFAELS--RRGY-YNNVVFHRIIRDFMIQGGD---PTGTGRGGASIY 87
            :|.|:::|:....|.|..||..||  .:|: |....|||||..||.||||   |.||  |..|||
Human    17 LGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGT--GDKSIY 79

  Fly    88 GSEFADELHGDL--RHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKR 150
            |.:|.||   :|  :|||:|||||||:||:||||||||..|.|:||||||..||:      |.:|
Human    80 GEKFDDE---NLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGK------VKER 135

  Fly   151 IGMVE 155
            :.:||
Human   136 VNIVE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 68/135 (50%)
PPIAL4ENP_001137504.2 cyclophilin 4..162 CDD:294131 68/135 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.