DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Ppil6

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_017457315.1 Gene:Ppil6 / 685567 RGDID:1592581 Length:332 Species:Rattus norvegicus


Alignment Length:134 Identity:56/134 - (41%)
Similarity:73/134 - (54%) Gaps:17/134 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FVTLETS-----MGEITVELYWKHAPNTCRNFAEL-------SRRG---YYNNVVFHRIIRDFMI 71
            ||.|:.|     :|.:..|||....|.||.||..|       |.||   :|.:.:|||::::..:
  Rat   145 FVFLDISIDLAPIGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGIKLHYKDSIFHRVVKNGWV 209

  Fly    72 QGGD-PTGTGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKH 135
            |||| ..|.|..|.||||..|.|| :..:.|...|:|.|.|.|..||||||:|||..|.:||.|:
  Rat   210 QGGDIVEGRGDDGESIYGPTFEDE-NFSVPHNKRGVLGMVNKGHHTNGSQFYITLQATPYLDKKY 273

  Fly   136 TIFG 139
            ..||
  Rat   274 VAFG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 54/132 (41%)
Ppil6XP_017457315.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.