DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppil1

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001029350.1 Gene:ppil1 / 558042 ZFINID:ZDB-GENE-051009-1 Length:166 Species:Danio rerio


Alignment Length:162 Identity:113/162 - (69%)
Similarity:137/162 - (84%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GIPDKAWQPHFVTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDP 76
            |||..:|||..|:|:|:||.|.:||||.|||.||:|||||.||||||:..|||||:|||:|||||
Zfish     3 GIPPDSWQPPTVSLDTTMGTIVLELYWNHAPKTCKNFAELGRRGYYNSTKFHRIIKDFMVQGGDP 67

  Fly    77 TGTGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRV 141
            ||||||||||||.:|.||.|.:|:.||||||:|||:||||||||||::|||||||||||||||||
Zfish    68 TGTGRGGASIYGKQFEDEFHPELKFTGAGILAMANAGPDTNGSQFFLSLAPTQWLDGKHTIFGRV 132

  Fly   142 YTGMEVVKRIGMVETDKNDRPVDPLRIIKAKV 173
            ..|:.|:.|||||||:..|||||.::|::..:
Zfish   133 CQGIGVLNRIGMVETNSQDRPVDDIKILRVNL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 106/145 (73%)
ppil1NP_001029350.1 cyclophilin 16..161 CDD:294131 106/144 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589243
Domainoid 1 1.000 240 1.000 Domainoid score I2225
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9367
Inparanoid 1 1.050 252 1.000 Inparanoid score I3188
OMA 1 1.010 - - QHG61277
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto40679
orthoMCL 1 0.900 - - OOG6_102285
Panther 1 1.100 - - LDO PTHR45625
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R963
SonicParanoid 1 1.000 - - X2633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.