DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppil6

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001018433.1 Gene:ppil6 / 553623 ZFINID:ZDB-GENE-050522-70 Length:293 Species:Danio rerio


Alignment Length:209 Identity:73/209 - (34%)
Similarity:99/209 - (47%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSDPNNAGGIPDKAW-----QPH---------------------FVTLE-----TSMGEITVELY 37
            |.|.....|..:|.|     :|.                     ||.::     .::|.:..||:
Zfish    80 LGDERKLSGWAEKEWKFTFHRPQALYMALAEEFYISNLRSTGHIFVYMDIENGGEAVGRLLFELF 144

  Fly    38 WKHAPNTCRNF-------AELSRRGY---YNNVVFHRIIRDFMIQGGD--PTGTGRGGASIYGSE 90
            ....|.|||||       |.||:...   |...||||::.:..|||||  |...|.||.||||..
Zfish   145 SDVCPKTCRNFKALCTGEAGLSKSNLELSYKGSVFHRVVPNGWIQGGDISPEKKGTGGESIYGPT 209

  Fly    91 FADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMVE 155
            |.|| :..:.|...|||.|||.|..:|||||:|||.|..|:|.|:..||::..|.:|:||:..|.
Zfish   210 FEDE-NFVISHNKRGILGMANQGAHSNGSQFYITLQPATWMDQKYVAFGQLAEGTDVLKRLEAVP 273

  Fly   156 TDKNDRPVDPLRII 169
            | .|:||....:|:
Zfish   274 T-YNERPKQDCKIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 65/163 (40%)
ppil6NP_001018433.1 cyclophilin 125..289 CDD:294131 66/164 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.