DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and PPID

DIOPT Version :10

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_005029.1 Gene:PPID / 5481 HGNCID:9257 Length:370 Species:Homo sapiens


Alignment Length:147 Identity:66/147 - (44%)
Similarity:85/147 - (57%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MGEITVELYWKHAPNTCRNFAEL--SRRG---------YYNNVVFHRIIRDFMIQGGD-PTGTGR 81
            :|.|.:||:....|.|..||..|  ..:|         ::....|||||:.||||||| ....|.
Human    29 VGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGT 93

  Fly    82 GGASIYGSEFADE-LHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGM 145
            ||.||||.:|.|| .|  .:|...|:|||||:|.:|||||||||..||..|||||.:||:|..|:
Human    94 GGESIYGEKFEDENFH--YKHDREGLLSMANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGI 156

  Fly   146 EVVKRIGMVETDKNDRP 162
            .|.:.:..||. |.::|
Human   157 GVARILENVEV-KGEKP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:469651 66/147 (45%)
PPIDNP_005029.1 cyclophilin_ABH_like 16..182 CDD:238907 66/147 (45%)
Chaperone activity. /evidence=ECO:0000250 185..215
TPR 213..>367 CDD:440225
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370
TPR repeat 224..267 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..333 CDD:276809
TPR repeat 341..364 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.