DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and PPIL1

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:159 Identity:121/159 - (76%)
Similarity:137/159 - (86%) Gaps:0/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IPDKAWQPHFVTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPT 77
            ||..:|||..|.||||||.|.:||||||||.||:|||||:||||||...|||||:||||||||||
Human     4 IPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPT 68

  Fly    78 GTGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVY 142
            |||||||||||.:|.||||.||:.||||||:|||:||||||||||:||||||||||||||||||.
Human    69 GTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVC 133

  Fly   143 TGMEVVKRIGMVETDKNDRPVDPLRIIKA 171
            .|:.:|.|:|||||:..|||||.::||||
Human   134 QGIGMVNRVGMVETNSQDRPVDDVKIIKA 162

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 112/145 (77%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 112/145 (77%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 9/10 (90%)