DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppil1

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001005007.1 Gene:ppil1 / 448493 XenbaseID:XB-GENE-963801 Length:166 Species:Xenopus tropicalis


Alignment Length:160 Identity:116/160 - (72%)
Similarity:135/160 - (84%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GIPDKAWQPHFVTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDP 76
            |||...|||..|.||||||.|||||||.|||.||:|||||:||||||...|||||:|||:|||||
 Frog     3 GIPHDTWQPPHVLLETSMGTITVELYWLHAPMTCKNFAELARRGYYNGTKFHRIIKDFMVQGGDP 67

  Fly    77 TGTGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRV 141
            ||||||||||||.:|.||:|.||:.||||||:|||:|||:||||||:||||||||||||:|||||
 Frog    68 TGTGRGGASIYGKQFEDEIHPDLKFTGAGILAMANAGPDSNGSQFFLTLAPTQWLDGKHSIFGRV 132

  Fly   142 YTGMEVVKRIGMVETDKNDRPVDPLRIIKA 171
            ..|:..:.|:||||||..||.:|.:||::|
 Frog   133 SHGLGTLNRLGMVETDSQDRSLDDVRILRA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 108/145 (74%)
ppil1NP_001005007.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 108/145 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 241 1.000 Domainoid score I2211
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9367
Inparanoid 1 1.050 255 1.000 Inparanoid score I3101
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto102707
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.