DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppil3

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001004983.1 Gene:ppil3 / 448435 XenbaseID:XB-GENE-957807 Length:161 Species:Xenopus tropicalis


Alignment Length:152 Identity:69/152 - (45%)
Similarity:98/152 - (64%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY 87
            |||.|.:|||.:||:.:.||....||..|....||...:|||.|:.||:|.|||||||:||.||:
 Frog     3 VTLHTDLGEIKIELFCERAPKASENFLALCASNYYTGCLFHRNIKGFMVQTGDPTGTGKGGQSIW 67

  Fly    88 GSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIG 152
            |.:|.||....|:|:..|::||||:||:||.||||||......||.|:|:||:|..|::.:..:.
 Frog    68 GRKFEDEYSEFLKHSVRGVVSMANNGPNTNASQFFITYGKQPHLDMKYTVFGKVIDGLDTLDELE 132

  Fly   153 MVET-DKNDRPVDPLRIIKAKV 173
            .:.. :|:.||:..:||..|.:
 Frog   133 KLPVHEKSFRPLTEVRIKDATI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 67/146 (46%)
ppil3NP_001004983.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 69/150 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.