DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppid

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001002065.1 Gene:ppid / 415155 ZFINID:ZDB-GENE-040625-34 Length:371 Species:Danio rerio


Alignment Length:179 Identity:79/179 - (44%)
Similarity:97/179 - (54%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PDKAWQPH-FVTLETS---MGEITVELYWKHAPNTCRNFAEL--SRRG---------YYNNVVFH 63
            |..|..|. |..:|..   :|.:..||:....|.|..||..|  ..:|         ::....||
Zfish    10 PGNAENPRVFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFH 74

  Fly    64 RIIRDFMIQGGD-PTGTGRGGASIYGSEFADE-LHGDLRHTGAGILSMANSGPDTNGSQFFITLA 126
            |||:.||||||| ....|.||.||||.:|.|| .|  .:|...|:|||||:||:|||||||||..
Zfish    75 RIIKSFMIQGGDFSNQNGTGGESIYGDKFEDENFH--YKHDREGLLSMANAGPNTNGSQFFITTV 137

  Fly   127 PTQWLDGKHTIFGRVYTGMEVVKRIGMVETDKNDRPVDPLRIIKAKVEK 175
            ||..|||||.:||:|..||.|||.:..:|| |.|.||.|..|.:....|
Zfish   138 PTPHLDGKHVVFGQVLKGMGVVKMLEAMET-KEDNPVKPCVIAECGEHK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 74/161 (46%)
ppidNP_001002065.1 cyclophilin_ABH_like 16..182 CDD:238907 76/168 (45%)
TPR_11 223..304 CDD:290150
TPR repeat 223..268 CDD:276809
TPR_12 271..340 CDD:290160
TPR repeat 273..303 CDD:276809
TPR repeat 308..336 CDD:276809
TPR_1 309..341 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.