DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppib

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_998184.1 Gene:ppib / 406292 ZFINID:ZDB-GENE-040426-1955 Length:216 Species:Danio rerio


Alignment Length:153 Identity:78/153 - (50%)
Similarity:99/153 - (64%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GEITVELYWKHAPNTCRNFAELS--RRGY-YNNVVFHRIIRDFMIQGGDPT-GTGRGGASIYGSE 90
            |.|.:.|:.|..|.|..||.:|:  .:|: |....|||:|:||||||||.| |.|.||.||||..
Zfish    58 GRIVIGLFGKTVPKTTENFLQLATGEKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDR 122

  Fly    91 FADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMVE 155
            |.|| :..|:|.|.|.|||||:|.||||||||||...|.||||||.:||::..||:||::|...:
Zfish   123 FPDE-NFKLKHYGPGWLSMANAGKDTNGSQFFITTVQTPWLDGKHVVFGKILEGMDVVRKIEATK 186

  Fly   156 TDKNDRPVDPLRII---KAKVEK 175
            ||..|:|:..:.|.   |..|||
Zfish   187 TDGRDKPLKDVSIHDSGKIDVEK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 74/146 (51%)
ppibNP_998184.1 cyclophilin_ABH_like 45..203 CDD:238907 74/145 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.