DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Cwc27

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_017446439.1 Gene:Cwc27 / 361887 RGDID:1310697 Length:471 Species:Rattus norvegicus


Alignment Length:153 Identity:76/153 - (49%)
Similarity:101/153 - (66%) Gaps:3/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY 87
            |.|:|:.|:|.:||:.|.||..||||.:|....||:|.:|||::..|::|||||||||.||.|:|
  Rat    15 VLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTGTGTGGESVY 79

  Fly    88 GSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIG 152
            |:.|.||.|..||....|:::|||:||..||||||.||.....|:.||||||:| ||..|...:.
  Rat    80 GAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKV-TGDTVYNMLR 143

  Fly   153 MVETDKND--RPVDPLRIIKAKV 173
            :.|.|.:|  ||.:|.||...:|
  Rat   144 LTEVDIDDEERPRNPHRIKSCEV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 74/147 (50%)
Cwc27XP_017446439.1 cyclophilin_CeCYP16-like 8..177 CDD:238906 76/153 (50%)
TMEM119 <308..>359 CDD:292352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.