DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Ppial4g

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:125 Identity:60/125 - (48%)
Similarity:79/125 - (63%) Gaps:5/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MGEITVELYWKHAPNTCRNFAELS--RRGY-YNNVVFHRIIRDFMIQGGDPT-GTGRGGASIYGS 89
            :|.:::||:....|.|..||..|:  .:|: |....|||||..||.|||..| ..|.||.||||.
  Rat    17 LGRVSLELFADKVPRTAENFRSLTTGEKGFGYKGSSFHRIIPGFMCQGGKVTCHNGTGGKSIYGE 81

  Fly    90 EFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVK 149
            :|.::.. .|:|||.|||||||:||:||||||||..|.|:.||||..:||:...|..:|:
  Rat    82 KFENDSF-ILKHTGPGILSMANAGPNTNGSQFFICTAKTERLDGKCVVFGKGRGGTNIVE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 60/125 (48%)
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:294131 60/125 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.