DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppiab

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001315353.1 Gene:ppiab / 335519 ZFINID:ZDB-GENE-030131-7459 Length:164 Species:Danio rerio


Alignment Length:126 Identity:66/126 - (52%)
Similarity:80/126 - (63%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHRIIRDFMIQGGDPTG-TGRGGASIYGSE 90
            |.|.:||.....|.|..||..|  ..:|: |....|||:|..||.||||.|. .|.||.||||::
Zfish    18 GRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFMCQGGDFTNHNGTGGKSIYGNK 82

  Fly    91 FADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRI 151
            |.|| :..|:|.|.|.|||||:||:||||||||..|.|.||||||.:||:|..|::||..|
Zfish    83 FEDE-NFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNWLDGKHVVFGKVVDGLDVVDAI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 66/126 (52%)
ppiabNP_001315353.1 cyclophilin_ABH_like 4..162 CDD:238907 66/126 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.