DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Ppil3

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:147 Identity:71/147 - (48%)
Similarity:98/147 - (66%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY 87
            |||.|.:|:|.:|::.:..|.||.||..|....|||..||||.|:.||:|.||||||||||:||:
  Rat     3 VTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIW 67

  Fly    88 GSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIG 152
            |.:|.||....|:|...|::||||:||:|||||||||......||.|:|:||:|..|:|.:..:.
  Rat    68 GKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELE 132

  Fly   153 MVE-TDKNDRPVDPLRI 168
            .:. .:|..||::.:.|
  Rat   133 KLPVNEKTYRPLNDVHI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 70/146 (48%)
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 71/147 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.