DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Ppic

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001004215.1 Gene:Ppic / 291463 RGDID:1303221 Length:212 Species:Rattus norvegicus


Alignment Length:150 Identity:76/150 - (50%)
Similarity:96/150 - (64%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ETSMGEITVELYWKHAPNTCRNFAELS--RRGY-YNNVVFHRIIRDFMIQGGDPTG-TGRGGASI 86
            :..:|.|.:.|:.|..|.|..||..|:  .:|| |...:|||:|:||||||||.|. .|.||.||
  Rat    48 DKDVGRIVIGLFGKVVPRTVENFVTLATGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSI 112

  Fly    87 YGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRI 151
            ||..|.|| :..|:|.|.|.:||||:|||||||||||||....||||||.:||:|..||.||..|
  Rat   113 YGETFPDE-NFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPAWLDGKHVVFGKVLDGMTVVHSI 176

  Fly   152 GMVETDKNDRPVDPLRIIKA 171
            .:..||.:|||:....|:.:
  Rat   177 ELQATDDHDRPLTDCTIVNS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 76/147 (52%)
PpicNP_001004215.1 cyclophilin_ABH_like 38..197 CDD:238907 76/149 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.