DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and cyp1

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_593308.1 Gene:cyp1 / 2543019 PomBaseID:SPAC57A10.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:103/149 - (69%)
Similarity:128/149 - (85%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY 87
            |.|:||:|:|.:|||.:|||.||:||..|::.|||:.|:|||:|.||:|||||||||||||.|||
pombe     4 VELQTSLGKILIELYTEHAPKTCQNFYTLAKEGYYDGVIFHRVIPDFVIQGGDPTGTGRGGTSIY 68

  Fly    88 GSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIG 152
            |.:|.||:|.||.|||||||||||:||:||.||||||||||.||||||||||||.:|:.|.||:|
pombe    69 GDKFDDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAPTPWLDGKHTIFGRVVSGLSVCKRMG 133

  Fly   153 MVETDKNDRPVDPLRIIKA 171
            ::.||.:|||::||:||||
pombe   134 LIRTDSSDRPIEPLKIIKA 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 99/145 (68%)
cyp1NP_593308.1 cyclophilin 6..151 CDD:294131 99/144 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 233 1.000 Domainoid score I493
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9367
Inparanoid 1 1.050 233 1.000 Inparanoid score I851
OMA 1 1.010 - - QHG61277
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto100697
orthoMCL 1 0.900 - - OOG6_102285
Panther 1 1.100 - - LDO PTHR45625
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R963
SonicParanoid 1 1.000 - - X2633
TreeFam 1 0.960 - -
1312.950

Return to query results.
Submit another query.