DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and CG32236

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster


Alignment Length:149 Identity:32/149 - (21%)
Similarity:52/149 - (34%) Gaps:58/149 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY-GSEFA 92
            ||.:.::||.:.:|.....|.   |...:|:|..||.:|.|              :::: .:|..
  Fly   243 MGRLLLQLYTELSPEVVLEFV---RMATHNDVGCHRFVRIF--------------SNLWMEAELV 290

  Fly    93 DELHGDL---------------------------RHTGAGILSMANSGPDTNGSQFFITLAPTQW 130
            ..:|..|                           ||...|:||...|        |..::.|.| 
  Fly   291 PAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLSYTIS--------FKQSVIPWQ- 346

  Fly   131 LDGKHTIFGRVYTGMEVVK 149
                ..|||||..|:.|::
  Fly   347 ----RVIFGRVCGGLRVLQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 32/149 (21%)
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 32/149 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.