DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Ppwd1

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_766395.2 Gene:Ppwd1 / 238831 MGIID:2443069 Length:646 Species:Mus musculus


Alignment Length:151 Identity:86/151 - (56%)
Similarity:104/151 - (68%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYGS 89
            :.||||:|.::|:....|.|..||...||.||||...|||||:.||||.|||||||.||.||:|.
Mouse   496 VHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGG 560

  Fly    90 EFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMV 154
            ||.||.|..|||.....|||||:|.:|||||||||:.||.|||.|||:||||..|||||:||..|
Mouse   561 EFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNV 625

  Fly   155 ETD-KNDRPVDPLRIIKAKVE 174
            :.: |.|:|.:.:.||...|:
Mouse   626 KVNPKTDKPYEDVSIINITVK 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 84/145 (58%)
Ppwd1NP_766395.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
WD 1 88..126
WD40 89..>318 CDD:295369
WD40 <89..311 CDD:225201
WD 2 131..170
WD40 repeat 136..177 CDD:293791
WD40 repeat 191..219 CDD:293791
WD 3 221..260
WD40 repeat 226..277 CDD:293791
WD 4 278..319
WD40 repeat 283..326 CDD:293791
cyclophilin_WD40 495..643 CDD:238908 85/146 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.