DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and cyn-12

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_501118.1 Gene:cyn-12 / 191627 WormBaseID:WBGene00000888 Length:169 Species:Caenorhabditis elegans


Alignment Length:153 Identity:105/153 - (68%)
Similarity:129/153 - (84%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QPHFVTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGG 83
            |..:|.|:|:||:|.:||||.|||.||:||::|::|.|||..:|||||.||||||||||||||||
 Worm     8 QAPYVILDTTMGKIALELYWNHAPRTCQNFSQLAKRNYYNGTIFHRIIADFMIQGGDPTGTGRGG 72

  Fly    84 ASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVV 148
            |||||.:|:||:...|:|||||||||||:||:||||||||||||||.|||||||||||..||:|:
 Worm    73 ASIYGDKFSDEIDERLKHTGAGILSMANAGPNTNGSQFFITLAPTQHLDGKHTIFGRVAAGMKVI 137

  Fly   149 KRIGMVETDKNDRPVDPLRIIKA 171
            ..:|.|:||.:|||...:||:||
 Worm   138 ANMGRVDTDNHDRPKIEIRILKA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 101/145 (70%)
cyn-12NP_501118.1 cyclophilin_SpCYP2_like 13..159 CDD:238903 101/145 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163357
Domainoid 1 1.000 229 1.000 Domainoid score I1408
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9367
Inparanoid 1 1.050 229 1.000 Inparanoid score I2202
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61277
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto20302
orthoMCL 1 0.900 - - OOG6_102285
Panther 1 1.100 - - LDO PTHR45625
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R963
SonicParanoid 1 1.000 - - X2633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.