DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Ppib

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_035279.2 Gene:Ppib / 19035 MGIID:97750 Length:216 Species:Mus musculus


Alignment Length:157 Identity:78/157 - (49%)
Similarity:103/157 - (65%) Gaps:8/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ETSMGEITVELYWKHAPNTCRNFAELS--RRGY-YNNVVFHRIIRDFMIQGGDPT-GTGRGGASI 86
            :.|:|.:...|:.|..|.|..||..|:  .:|: |.|..|||:|:||||||||.| |.|.||.||
Mouse    54 DESVGRVVFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSI 118

  Fly    87 YGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRI 151
            ||..|.|| :..|:|.|.|.:||||:|.||||||||||...|.||||||.:||:|..||:||:::
Mouse   119 YGERFPDE-NFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKV 182

  Fly   152 GMVETDKNDRPVDPLRII---KAKVEK 175
            ...:||..|:|:..:.|:   |.:|||
Mouse   183 ESTKTDSRDKPLKDVIIVDSGKIEVEK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 74/150 (49%)
PpibNP_035279.2 cyclophilin_ABH_like 45..203 CDD:238907 74/149 (50%)
Prevents secretion from ER. /evidence=ECO:0000250 213..216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.