DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and cyn-8

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_509507.1 Gene:cyn-8 / 181136 WormBaseID:WBGene00000884 Length:447 Species:Caenorhabditis elegans


Alignment Length:156 Identity:78/156 - (50%)
Similarity:89/156 - (57%) Gaps:20/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GEITVELYWKH-APNTCRNF-----AELSR-RGY---YNNVVFHRIIRDFMIQGGDPT-GTGRGG 83
            |.|...| |.| .|.|..||     .||.: .|:   |...||||:|:.|||||||.| |.|.||
 Worm    23 GRIVFSL-WNHCCPRTVENFRAFCTGELGKMNGHYASYQGSVFHRVIKGFMIQGGDITHGNGTGG 86

  Fly    84 ASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVV 148
            .||||..|.|| :..|:|....:|||||.||||||||||||......|||||.:||.|..|:|||
 Worm    87 YSIYGRTFDDE-NLALKHKKPYLLSMANRGPDTNGSQFFITSEEVPHLDGKHCVFGEVIKGVEVV 150

  Fly   149 KRIGMVETDKNDRPVDPLRIIKAKVE 174
            |.|..:||...|:||       .|||
 Worm   151 KAIENLETGNEDKPV-------CKVE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 75/150 (50%)
cyn-8NP_509507.1 cyclophilin 10..174 CDD:412213 78/156 (50%)
ATP-synt_Fo_b <324..391 CDD:349951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.